Chicken Secondary Antibodies
Jackson Immuno Research Labs R-Phycoerythrin AffiniPure F(ab')₂ Fragment Donkey Anti-Human IgM, Fc5μ fragment specific, 1ml
R-Phycoerythrin-AffiniPure F(ab')2 Fragment Donkey Anti-Human IgM, Fc5u Fragment Specific (min X Bov,Hrs Sr Prot)
Kingfisher Biotech Inc Chicken TNFSF15 Recombinant Protein
The Chicken TNFSF15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken TNFSF15 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Recombinant Protein
The Chicken IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQ LQDDIDKLKA DFNSSHSDVA DGGPIIVEKL KNWTERNEKR IILSQIVSMY LEMLENTDKS KPHIKHISEE LYTLKNNLPD GVKKVKDIMD LAKLPMNDLR IQRKAANELF SILQKLVDPP SFKRKRSQSQ RRCNC (145)) (Gene ID: 396054). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-4 Recombinant Protein
The Chicken IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-8 Specifications: (Molecular Weight: 12.4 kDa) (Amino Acid Sequence: LQLSVPLMES IRIVNDIQGE VSCVKMNVTD IFADNKTNNK TELLCKASTI VWESQHCHKN LQGLFLNMRQ LLNASSTSLK APCPTAAGNT TSMEKFLADL RTFFHQLAKN K) (Gene ID: 416330). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Recombinant Protein
The Chicken IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQ LQDDIDKLKA DFNSSHSDVA DGGPIIVEKL KNWTERNEKR IILSQIVSMY LEMLENTDKS KPHIKHISEE LYTLKNNLPD GVKKVKDIMD LAKLPMNDLR IQRKAANELF SILQKLVDPP SFKRKRSQSQ RRCNC (145)) (Gene ID: 396054). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IL-2 Recombinant Protein
The Chicken IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958). For research use only. Made in the USA
CPC Scientific H-Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (trifluoroacetate salt) 0.5MG
Single chain peptide with 32 amino acids that stimulates bone formation by inhibiting osteoblasts, induces bone reabsorption and increases cAMP levels in osteoclasts.ONE-LETTER SEQUENCE: CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Cys1 and 7 bridge)MOLECULAR FORMULA: C145H240N42O46S2MOLECULAR WEIGHT:3371.9STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [100016-62-4], RESEARCH AREA: OsteoporosisREFERENCES: T. Kurihara et al., Peptide Chemistry, 1985, 173 (1986)
CPC Scientific (Suc-Ala-Ala-Pro-Phe)2-R110 0.5MG
Chymotrypsin.SEQUENCE: (Suc-Ala-Ala-Pro-Phe)2-R110ONE-LETTER SEQUENCE: (Suc-AAPF)2-R110MOLECULAR FORMULA: C68N74N10O17MOLECULAR WEIGHT: 1304.4STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: SYNONYMS: RESEARCH AREA: ApoptosisREFERENCES:Biol Chem Hoppe-Seyler 373, 433 (1992)Nature 361, 274 (1993)SKU(s): SUBS-007A, SUBS-007B
Sigma Aldrich Fine Chemicals Biosciences 6-Hexachloro-Fluorescein Phosphoramidite configured for PerkinElmer, configured for Polygen | 1360547-55-2 | MFCD01940924 | 0.1MMOL
6-Hexachloro-Fluorescein Phosphoramidite configured for PerkinElmer, configured for Polygen | Purity: >=97% (31P-NMR); >=97.0% (reversed phase HPLC); conforms (1H-NMR) | Mol Wt: 1050.61 | 1360547-55-2 | MFCD01940924 | 0.1MMOL
Sigma Aldrich Fine Chemicals Biosciences 6-Hexachloro-Fluorescein Phosphoramidite configured for ABI | 1360547-55-2 | MFCD01940924 | 0.1MMOL
6-Hexachloro-Fluorescein Phosphoramidite configured for ABI | Purity: >=97% (31P-NMR); >=97.0% (reversed phase HPLC); conforms (1H-NMR) | Mol Wt: 1050.61 | 1360547-55-2 | MFCD01940924 | 0.1MMOL
Immunoreagents Inc CHICKEN A-RABBIT IGG ALP
Secondary Antibody; Chicken anti-rabbit IgG (H&L) - Affinity Pure, ALP Conjugate, Host: Chicken, Format: Liq, Label: ALP, Applications: WB, ELISA
Immunoreagents Inc CHICKEN A-GOAT IGG ALP 0.5 MG
Secondary Antibody; Chicken anti-goat IgG (H&L), Affinity Pure, min x w/Hu,Mu or RB IgG/SP, ALP Conjugate, Host: Chicken, Format: Liq, Label: ALP, Applications: WB, ELISA